cpsf2 antibody Search Results


90
Bio-Techne corporation cpsf2 antibody
Cpsf2 Antibody, supplied by Bio-Techne corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/cpsf2 antibody/product/Bio-Techne corporation
Average 90 stars, based on 1 article reviews
cpsf2 antibody - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

92
Santa Cruz Biotechnology nb100 79827 everyblot blocking buffer cpsf100 scbt
Nb100 79827 Everyblot Blocking Buffer Cpsf100 Scbt, supplied by Santa Cruz Biotechnology, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/nb100 79827 everyblot blocking buffer cpsf100 scbt/product/Santa Cruz Biotechnology
Average 92 stars, based on 1 article reviews
nb100 79827 everyblot blocking buffer cpsf100 scbt - by Bioz Stars, 2026-06
92/100 stars
  Buy from Supplier

93
Proteintech cpsf2
Cpsf2, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/cpsf2/product/Proteintech
Average 93 stars, based on 1 article reviews
cpsf2 - by Bioz Stars, 2026-06
93/100 stars
  Buy from Supplier

91
Novus Biologicals cpsf100
Cpsf100, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/cpsf100/product/Novus Biologicals
Average 91 stars, based on 1 article reviews
cpsf100 - by Bioz Stars, 2026-06
91/100 stars
  Buy from Supplier

N/A
CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA. Rabbit polyclonal CPSF2 antibody raised against the N terminal of CPSF2.
  Buy from Supplier

N/A
The CPSF2 Antibody [Alexa Fluor® 594] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
  Buy from Supplier

N/A
The CPSF2 Antibody [Alexa Fluor® 647] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
  Buy from Supplier

N/A
The CPSF2 Antibody [DyLight 550] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
  Buy from Supplier

N/A
The CPSF2 Antibody [FITC] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
  Buy from Supplier

N/A
CPSF2 Antibody raised in Rabbit validated in WB in Human, Mouse, Rat.
  Buy from Supplier

N/A
The CPSF2 Antibody [DyLight 350] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
  Buy from Supplier

Image Search Results