90
|
Bio-Techne corporation
cpsf2 antibody Cpsf2 Antibody, supplied by Bio-Techne corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/cpsf2 antibody/product/Bio-Techne corporation Average 90 stars, based on 1 article reviews
cpsf2 antibody - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
92
|
Santa Cruz Biotechnology
nb100 79827 everyblot blocking buffer cpsf100 scbt Nb100 79827 Everyblot Blocking Buffer Cpsf100 Scbt, supplied by Santa Cruz Biotechnology, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/nb100 79827 everyblot blocking buffer cpsf100 scbt/product/Santa Cruz Biotechnology Average 92 stars, based on 1 article reviews
nb100 79827 everyblot blocking buffer cpsf100 scbt - by Bioz Stars,
2026-06
92/100 stars
|
Buy from Supplier |
93
|
Proteintech
cpsf2 Cpsf2, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/cpsf2/product/Proteintech Average 93 stars, based on 1 article reviews
cpsf2 - by Bioz Stars,
2026-06
93/100 stars
|
Buy from Supplier |
91
|
Novus Biologicals
cpsf100 Cpsf100, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/cpsf100/product/Novus Biologicals Average 91 stars, based on 1 article reviews
cpsf100 - by Bioz Stars,
2026-06
91/100 stars
|
Buy from Supplier |
N/A
|
CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA. Rabbit polyclonal CPSF2 antibody raised against the N terminal of CPSF2.
|
Buy from Supplier |
N/A
|
The CPSF2 Antibody [Alexa Fluor® 594] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
|
Buy from Supplier |
N/A
|
The CPSF2 Antibody [Alexa Fluor® 647] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
|
Buy from Supplier |
N/A
|
The CPSF2 Antibody [DyLight 550] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
|
Buy from Supplier |
N/A
|
The CPSF2 Antibody [FITC] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
|
Buy from Supplier |
N/A
|
CPSF2 Antibody raised in Rabbit validated in WB in Human, Mouse, Rat.
|
Buy from Supplier |
N/A
|
The CPSF2 Antibody [DyLight 350] from Novus is a CPSF2 antibody to CPSF2. This antibody reacts with Human. The CPSF2 antibody has been validated for the following applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin.
|
Buy from Supplier |